PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG035000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 338aa    MW: 38255.1 Da    PI: 8.3367
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG035000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS238.72.5e-733314110374
                 GRAS 110 ervHiiDfdis..qGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL... 194
                          + v iiD++ s  ++ QW+ Ll+ +  R++gpp++R+T+v++    +++ l +++  L++ A++l++pf+f+  v  rle+l+l++L   
  Pavir.8KG035000.1.p   3 KVVRIIDLSCStaHPWQWLKLLHDFHGRQGGPPEVRLTVVHD----DNDYLANMRILLSNEADKLKIPFQFSS-VIGRLETLDLSNLrnt 87 
                          6789****87633799**************************....9**************************.6899999999888544 PP

                 GRAS 195 .rvkpgEalaVnlvlqlhrll...........................................desvsleserdevLklvkslsPkvvv 240
                           ++k gEa+a++++lq+hrll                                           + + ++++   ++L++v+ l+P+++ 
  Pavir.8KG035000.1.p  88 lDIKYGEAIAISCSLQMHRLLvvddkvscsgigqlqkmaniaqlnqmassvyspastlnypqtpSPQCKMPKLLATFLSAVRALKPNIML 177
                          47777********************************************************99988888999999*************** PP

                 GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                          v+eq+a+hn+  F +rf+eal+yy+alfds++a ++++    +er+ vEr++lg+ei+n++ ceg  r erhe+l++W + ++++GF  v
  Pavir.8KG035000.1.p 178 VMEQDANHNALLFCDRFAEALNYYAALFDSFHAVVAANPrraDERSRVERMILGEEIKNILLCEGVYRHERHERLSQWAMHMDRSGFDHV 267
                          *******************************87764443344************************************************ PP

                 GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          pls +a  + +  l  ++ +g + + e+++l+l+W +r L+s+SaWr
  Pavir.8KG035000.1.p 268 PLSFRAIWEGNQKLMSFGLNGCQSKVENDCLLLCWGSRHLYSISAWR 314
                          **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.3811294IPR005202Transcription factor GRAS
PfamPF035148.6E-713314IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MNKVVRIIDL SCSTAHPWQW LKLLHDFHGR QGGPPEVRLT VVHDDNDYLA NMRILLSNEA  60
DKLKIPFQFS SVIGRLETLD LSNLRNTLDI KYGEAIAISC SLQMHRLLVV DDKVSCSGIG  120
QLQKMANIAQ LNQMASSVYS PASTLNYPQT PSPQCKMPKL LATFLSAVRA LKPNIMLVME  180
QDANHNALLF CDRFAEALNY YAALFDSFHA VVAANPRRAD ERSRVERMIL GEEIKNILLC  240
EGVYRHERHE RLSQWAMHMD RSGFDHVPLS FRAIWEGNQK LMSFGLNGCQ SKVENDCLLL  300
CWGSRHLYSI SAWRPHKGST SGSREHMLVQ PQRQIIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-1719314123375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619626.11e-171PREDICTED: scarecrow-like protein 3 isoform X1
TrEMBLA0A0A9C2J40.0A0A0A9C2J4_ARUDO; Uncharacterized protein
STRINGSi012421m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-71scarecrow-like 3